LL-37
Cathelicidin peptide studied in in-vitro antimicrobial research.
Specification
- Catalogue ID: SP123
- HPLC purity: 99.5%
- Formulation: Lyophilized
- Quantity: 5mg / Vial
- Price: £75.00
Antimicrobial peptide biology · innate immunity research
LL-37 is the only member of the cathelicidin family expressed in humans — a 37-amino-acid cationic antimicrobial peptide cleaved from the C-terminal domain of the precursor protein hCAP18. It is produced primarily by neutrophils, keratinocytes, and epithelial cells, and its name reflects the two N-terminal leucine residues and the 37-residue chain length.
LL-37 has been extensively characterised in vitro for its capacity to disrupt bacterial membranes through carpet or toroidal-pore mechanisms, with demonstrated activity against Gram-positive and Gram-negative organisms in minimum inhibitory concentration (MIC) assays. These properties make it one of the most studied human host-defence peptides in the antimicrobial literature.
Beyond direct antimicrobial activity, LL-37 is studied in vitro for innate immune signalling — specifically its ability to bind and neutralise lipopolysaccharide (LPS), modulate Toll-like receptor (TLR) activity, and act as a chemoattractant for neutrophils and monocytes in cell-migration models.
No physiological or therapeutic properties are claimed; supplied for in-vitro laboratory research use only.
Compound identity
- Molecular formula: C₂₀₅H₃₄₀N₆₀O₅₃S₂
- Molecular weight: 4493.31 Da
- Sequence: [LL-37, 37 aa]
- Solubility: Soluble in water or aqueous buffer at ≥1 mg/mL
- Reconstitution: Add 1 mL bacteriostatic water per 5 mg; swirl gently, do not vortex
For in-vitro laboratory research use only. Not for human or veterinary use, consumption, or therapeutic application. No medical claims are made.